PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS63721.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 209aa    MW: 23574.7 Da    PI: 5.0216
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS63721.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.5e-1389131447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      W ++E+ ll+++++++G g+W+ +a+++g ++++ qc+ ++ ky
       EPS63721.1  89 WNADEEMLLLEGIEMYGLGNWNEVAEHVG-TKSRSQCIYHYDKY 131
                      *****************************.***********988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002915.8E-92570IPR000433Zinc finger, ZZ-type
PfamPF005692.7E-92868IPR000433Zinc finger, ZZ-type
CDDcd023351.31E-212977No hitNo description
PROSITE profilePS5013510.8242972IPR000433Zinc finger, ZZ-type
SuperFamilySSF578504.36E-132992No hitNo description
PROSITE patternPS0135703158IPR000433Zinc finger, ZZ-type
SuperFamilySSF466891.2E-1384135IPR009057Homeodomain-like
PROSITE profilePS5129321.21784136IPR017884SANT domain
SMARTSM007174.5E-1285134IPR001005SANT/Myb domain
PfamPF002492.0E-1388131IPR001005SANT/Myb domain
CDDcd001674.56E-1389131No hitNo description
Gene3DG3DSA:1.10.10.609.9E-989132IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
RFKRKRIAQN LESEGNIAAG IHDTKKALYQ CNYCDKDISG KIRIKCVVCA DFDLCIECFS  60
IGAEVNPHES IHPYRVMDNL AFPFICPDWN ADEEMLLLEG IEMYGLGNWN EVAEHVGTKS  120
RSQCIYHYDK YYMNSPRFPL PDMSQLMGKS RDDLLAVAVE ESETEKGAVA SHEFDIKVEA  180
EFAPKIEYMA KIEKNEAGRS SSSKSPGSG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085400.19e-97PREDICTED: transcriptional adapter ADA2-like isoform X1
SwissprotQ75LL66e-78TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLS8CGK81e-157S8CGK8_9LAMI; Uncharacterized protein (Fragment)
STRINGGSMUA_Achr6P00130_0016e-86(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24471215
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]